(data stored in ACNUC7421 zone)

EMBL: CP001622.PE144

CP001622.PE144       Location/Qualifiers
FT   CDS             140918..141310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0145"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54456"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD0"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ACS54456.1"
FT                   /translation="MLNQDTDATRRDPNAKVTHSLIASDRVEGTRVYGADGRHIGSIER
FT                   LIIGKLDGRVAYAVLSFGGFLGIGHDHYPLPWEKLNYDTQLDGYRIDLTKEQIEGAPSY
FT                   SDDDDTWYNDNGRRVYDYYGVPPYWM"
     MLNQDTDATR RDPNAKVTHS LIASDRVEGT RVYGADGRHI GSIERLIIGK LDGRVAYAVL        60
     SFGGFLGIGH DHYPLPWEKL NYDTQLDGYR IDLTKEQIEG APSYSDDDDT WYNDNGRRVY       120
     DYYGVPPYWM                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page