(data stored in ACNUC7421 zone)

EMBL: CP001622.PE145

CP001622.PE145       Location/Qualifiers
FT   CDS             complement(141530..143983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0146"
FT                   /product="glycoside hydrolase family 2 sugar binding"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: rec:RHECIAT_CH0000551 beta-mannosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54457"
FT                   /db_xref="GOA:C6AZD1"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD1"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ACS54457.1"
FT                   /translation="MIEKTALNSGWTLSCNDTVRLGLPAAIPATVPGCVHLDLLANRLI
FT                   PDPYIDVNEITNDWIGKTDWTYRCSFEAMPDDARVQELVFDGLDTVAVISLNGEEIGCT
FT                   FNMHRTYRFDVSRLLKAGQNELTVTFRSAYAYGAEMEKHYGYRPNNYPGPGNLMRKMAC
FT                   NFGWDWGPTLVTAGLWKPVRLESWDRARLAETRVSAILSGGDGLVKVHARLARHGDKTP
FT                   LRLVAEIGGVSKTVAIAPDEDAVSFELALPSPQLWWPHHLGAQPLYPMTLRLFDEASDD
FT                   LLDSYQRELGFRSLRLDTAADDHGSAFTFIINDVPLFICGANWIPDDCFPPRLTAERYA
FT                   ARIEEAKAANIHMLRVWGGGIFEADEFYETCDRKGMLVWQDFLFACAAYPEEEPLRSEV
FT                   EAEVRDNVVRLMPHASLVLWNGNNENIWGFDEWGWRPIIKAGESWGLGYYLDLLPKLCA
FT                   ELDPDRPYYPGSPYSGSMEIEPNANGHGCKHIWDVWNDVGYEVYRNYIPRFCSEFGWQA
FT                   PAAWATIEESVHDAPLTPQSNGVFHHQKATEGNDKLIRGLSGHLPEPKTMDDWHFATQL
FT                   NQARAIRFGVEHMRSHRNICKGSVVWQFNDCWPVTSWAALDSAGRRKPLWYALKTAYDP
FT                   RLLTIQPRGGGLAAVAVNERTLFWRAKISGKRLKLDGTVLAEFEFWRLLCDRFEAKEFP
FT                   LPEEIVTPDLPKDEVIVVQMLDRRAFHYFVEDIELALPAPRLTVDVTSIEGGYGVKVTA
FT                   QNFLKDLCLMADRLDPDAVVDSMLVTLLPGESHVFVVKTTKAIGADDIVFGTVLRSAND
FT                   LTAGR"
     MIEKTALNSG WTLSCNDTVR LGLPAAIPAT VPGCVHLDLL ANRLIPDPYI DVNEITNDWI        60
     GKTDWTYRCS FEAMPDDARV QELVFDGLDT VAVISLNGEE IGCTFNMHRT YRFDVSRLLK       120
     AGQNELTVTF RSAYAYGAEM EKHYGYRPNN YPGPGNLMRK MACNFGWDWG PTLVTAGLWK       180
     PVRLESWDRA RLAETRVSAI LSGGDGLVKV HARLARHGDK TPLRLVAEIG GVSKTVAIAP       240
     DEDAVSFELA LPSPQLWWPH HLGAQPLYPM TLRLFDEASD DLLDSYQREL GFRSLRLDTA       300
     ADDHGSAFTF IINDVPLFIC GANWIPDDCF PPRLTAERYA ARIEEAKAAN IHMLRVWGGG       360
     IFEADEFYET CDRKGMLVWQ DFLFACAAYP EEEPLRSEVE AEVRDNVVRL MPHASLVLWN       420
     GNNENIWGFD EWGWRPIIKA GESWGLGYYL DLLPKLCAEL DPDRPYYPGS PYSGSMEIEP       480
     NANGHGCKHI WDVWNDVGYE VYRNYIPRFC SEFGWQAPAA WATIEESVHD APLTPQSNGV       540
     FHHQKATEGN DKLIRGLSGH LPEPKTMDDW HFATQLNQAR AIRFGVEHMR SHRNICKGSV       600
     VWQFNDCWPV TSWAALDSAG RRKPLWYALK TAYDPRLLTI QPRGGGLAAV AVNERTLFWR       660
     AKISGKRLKL DGTVLAEFEF WRLLCDRFEA KEFPLPEEIV TPDLPKDEVI VVQMLDRRAF       720
     HYFVEDIELA LPAPRLTVDV TSIEGGYGVK VTAQNFLKDL CLMADRLDPD AVVDSMLVTL       780
     LPGESHVFVV KTTKAIGADD IVFGTVLRSA NDLTAGR                                817
//

If you have problems or comments...

PBIL Back to PBIL home page