(data stored in ACNUC7421 zone)

EMBL: CP001622.PE146

CP001622.PE146       Location/Qualifiers
FT   CDS             complement(144065..144460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0147"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00481
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54458"
FT                   /db_xref="GOA:C6AZD2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54458.1"
FT                   /translation="MAKMIHSMIRVLDEARSVEFYERAFGLSVADRVDFETFTLIYISN
FT                   AETGFELELTVNKGRTAPYDLGNAYGHLAVSVEEVAVERERLSKLGLKPGELVELNRDG
FT                   KLFGLFFFISDPDGYKIEVLQRHGRFL"
     MAKMIHSMIR VLDEARSVEF YERAFGLSVA DRVDFETFTL IYISNAETGF ELELTVNKGR        60
     TAPYDLGNAY GHLAVSVEEV AVERERLSKL GLKPGELVEL NRDGKLFGLF FFISDPDGYK       120
     IEVLQRHGRF L                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page