(data stored in ACNUC7421 zone)

EMBL: CP001622.PE147

CP001622.PE147       Location/Qualifiers
FT   CDS             complement(144509..145258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0148"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000553
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54459"
FT                   /db_xref="GOA:C6AZD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54459.1"
FT                   /translation="MKLVVANLFRLAALALLLILLFRTEWLSFMLVPLTSNNAPAVYRQ
FT                   NSLASLAAGHLQLVIGSIVCSAVLAVVGGIFVTRESGADFLPLSRAIANAGQTFPPVAV
FT                   LALAVPATGFGAMPTLIALFLYGLLPIFENTVAGLKQVSPQVLDAADGMGMNGTQRLLR
FT                   VELPLALPLILEGLKVATVINIGTATIGSTVAAKGLGEVIIAGLISDNTAFILQGGLIV
FT                   GLMAVLIYDAMGLIEGAITRRIGLRAA"
     MKLVVANLFR LAALALLLIL LFRTEWLSFM LVPLTSNNAP AVYRQNSLAS LAAGHLQLVI        60
     GSIVCSAVLA VVGGIFVTRE SGADFLPLSR AIANAGQTFP PVAVLALAVP ATGFGAMPTL       120
     IALFLYGLLP IFENTVAGLK QVSPQVLDAA DGMGMNGTQR LLRVELPLAL PLILEGLKVA       180
     TVINIGTATI GSTVAAKGLG EVIIAGLISD NTAFILQGGL IVGLMAVLIY DAMGLIEGAI       240
     TRRIGLRAA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page