(data stored in ACNUC7421 zone)

EMBL: CP001622.PE148

CP001622.PE148       Location/Qualifiers
FT   CDS             complement(145255..146199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0149"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000554 probable proline/glycine
FT                   betaine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54460"
FT                   /db_xref="GOA:C6AZD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54460.1"
FT                   /translation="MTMIEIRNVTKRYGAATVVDDVSMSVEKGEITVIVGTSGSGKSTL
FT                   MRMINRLVPITEGEIFVGGQNVMDVPVTELRRKIGYAIQGHGLFPHRTVAQNIATVPQL
FT                   LDWDSARIAKRVEELLGLFNLDPATFADKYPHQLSGGQQQRVGVARALAAEPELLLMDE
FT                   PFGALDPVIRGKAQDDLLAIQKQFGTTVILVTHDMDEAFHLGNQIAVMSEGRLLQCSTP
FT                   EKILTEPADPFVQQLTGTSDRALKLMSLLPLKESMEPAKNGLAYALPQSLSLRDALAEM
FT                   IWQGVDEAAVQDGEKAPVGSISMTRLLELGRKA"
     MTMIEIRNVT KRYGAATVVD DVSMSVEKGE ITVIVGTSGS GKSTLMRMIN RLVPITEGEI        60
     FVGGQNVMDV PVTELRRKIG YAIQGHGLFP HRTVAQNIAT VPQLLDWDSA RIAKRVEELL       120
     GLFNLDPATF ADKYPHQLSG GQQQRVGVAR ALAAEPELLL MDEPFGALDP VIRGKAQDDL       180
     LAIQKQFGTT VILVTHDMDE AFHLGNQIAV MSEGRLLQCS TPEKILTEPA DPFVQQLTGT       240
     SDRALKLMSL LPLKESMEPA KNGLAYALPQ SLSLRDALAE MIWQGVDEAA VQDGEKAPVG       300
     SISMTRLLEL GRKA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page