(data stored in ACNUC7421 zone)

EMBL: CP001622.PE149

CP001622.PE149       Location/Qualifiers
FT   CDS             complement(146196..147362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0150"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000555
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54461"
FT                   /db_xref="GOA:C6AZD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54461.1"
FT                   /translation="MAETLAVRRLDRLGVVLVAGGIAATALMPFIYVKANRIAAGKPML
FT                   LLQLLPQPSVVILTVLLLLTAFATLFLRHAIARLAIATLCLAALIVAIGLVSAAATPPG
FT                   STVARMTPGGGFWVLFAVIGLVISDALVKIRLAPWMRIAALAAYTALLFISLSSGLLDS
FT                   LSIMKEFSTRAPQFETEAISHLLLAFGSLAIAVVLGLPLGILCFWVPKLRAIVLQGLSL
FT                   IQTIPSLALFGLLMLPLGYLATHVPLAAAIGIRGIGTAPALIALVLYSLLPIVANTVVG
FT                   LQGVDPSVRDAAAGMGLTRWQILVGIDMPLAFPVILTGIRIVLVQAIGMVTIAALIGGG
FT                   GFGIFIFQGLGQTAMDLVLLGAVPTVFFAFSSAVILDAVIESIRGSAA"
     MAETLAVRRL DRLGVVLVAG GIAATALMPF IYVKANRIAA GKPMLLLQLL PQPSVVILTV        60
     LLLLTAFATL FLRHAIARLA IATLCLAALI VAIGLVSAAA TPPGSTVARM TPGGGFWVLF       120
     AVIGLVISDA LVKIRLAPWM RIAALAAYTA LLFISLSSGL LDSLSIMKEF STRAPQFETE       180
     AISHLLLAFG SLAIAVVLGL PLGILCFWVP KLRAIVLQGL SLIQTIPSLA LFGLLMLPLG       240
     YLATHVPLAA AIGIRGIGTA PALIALVLYS LLPIVANTVV GLQGVDPSVR DAAAGMGLTR       300
     WQILVGIDMP LAFPVILTGI RIVLVQAIGM VTIAALIGGG GFGIFIFQGL GQTAMDLVLL       360
     GAVPTVFFAF SSAVILDAVI ESIRGSAA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page