(data stored in ACNUC7421 zone)

EMBL: CP001622.PE15

CP001622.PE15        Location/Qualifiers
FT   CDS             complement(11954..13192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0015"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: ret:RHE_CH00370 S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54327"
FT                   /db_xref="GOA:C6AYA3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA3"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACS54327.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGVNPWG
FT                   VRIACETLATTNRVVIAGEVRLPPSLMKKDKDGKDVINPSKFKAAARRAIKDIGYEQDG
FT                   FHWKKAKIDVLLHSQSADIAQGVDSAADQQGDEGAGDQGIMFGYACRETPDLMPAPIYY
FT                   SHKILQLLAVARKKGDGEVAKLGPDAKSQVTVRYVDGKPSEATSIVLSTQHLDESWVSK
FT                   KVRAVVEPYIREALGGLKIADDCKWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLADRCTIQISYAIGVAQPLSIYVDLH
FT                   GTGKVTEDQIEAAIRKNMDLSPTGIRRHLDLNKPIYAKTSAYGHFGRKAGRDGSFSWER
FT                   TDLVKALKESVKT"
     MRANYLFTSE SVAEGHPDKV CDRISDEIVD LVYREAAKTG VNPWGVRIAC ETLATTNRVV        60
     IAGEVRLPPS LMKKDKDGKD VINPSKFKAA ARRAIKDIGY EQDGFHWKKA KIDVLLHSQS       120
     ADIAQGVDSA ADQQGDEGAG DQGIMFGYAC RETPDLMPAP IYYSHKILQL LAVARKKGDG       180
     EVAKLGPDAK SQVTVRYVDG KPSEATSIVL STQHLDESWV SKKVRAVVEP YIREALGGLK       240
     IADDCKWYIN PTGKFVIGGP DGDAGLTGRK IIVDTYGGAA PHGGGAFSGK DTTKVDRSAA       300
     YAARYLAKNV VAAGLADRCT IQISYAIGVA QPLSIYVDLH GTGKVTEDQI EAAIRKNMDL       360
     SPTGIRRHLD LNKPIYAKTS AYGHFGRKAG RDGSFSWERT DLVKALKESV KT               412
//

If you have problems or comments...

PBIL Back to PBIL home page