(data stored in ACNUC7421 zone)

EMBL: CP001622.PE150

CP001622.PE150       Location/Qualifiers
FT   CDS             complement(147453..148361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0151"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: ret:RHE_CH00485 glycine
FT                   betaine ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54462"
FT                   /db_xref="GOA:C6AZD6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD6"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACS54462.1"
FT                   /translation="MLKKLALAVSLSAFAVGAAHAADVVVSSKIDTEGTLLGNVIALAL
FT                   EANGIKTQDRIALGATPVVRKAITAGEIDIYPEYTGNAGFFFNKADDAAWKNIDQGYEL
FT                   AKKLDYDANKIVWLTPSPANNTWALAVRSDVAGPNKLKSLTDFGKWVAGGGAAKLAASA
FT                   EFVNSAGALPAFQTTYGFQLKPDQMVVLSGGDTAATIKAAADQTNGVNTAMVYGTDGAI
FT                   EAAELTVLEDDKNVQQVYAPTPIIREEVLKANPKIEEVLSPIFKSLTADELRKLNAKIQ
FT                   VDGEPAKSVAEAYLKEKGFLK"
     MLKKLALAVS LSAFAVGAAH AADVVVSSKI DTEGTLLGNV IALALEANGI KTQDRIALGA        60
     TPVVRKAITA GEIDIYPEYT GNAGFFFNKA DDAAWKNIDQ GYELAKKLDY DANKIVWLTP       120
     SPANNTWALA VRSDVAGPNK LKSLTDFGKW VAGGGAAKLA ASAEFVNSAG ALPAFQTTYG       180
     FQLKPDQMVV LSGGDTAATI KAAADQTNGV NTAMVYGTDG AIEAAELTVL EDDKNVQQVY       240
     APTPIIREEV LKANPKIEEV LSPIFKSLTA DELRKLNAKI QVDGEPAKSV AEAYLKEKGF       300
     LK                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page