(data stored in ACNUC7421 zone)

EMBL: CP001622.PE151

CP001622.PE151       Location/Qualifiers
FT   CDS             148783..150003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0152"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rec:RHECIAT_CH0000558 probable transcriptional
FT                   regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54463"
FT                   /db_xref="GOA:C6AZD7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54463.1"
FT                   /translation="MHLGALFIASHVLTSGSVRETARRFHLSPSTVSTAIHNLETELAM
FT                   TLTERASGELAMLIASGRVLEGLKPIMAAIGELGQWAGHDGDGAEIDEVWASRIPVKIV
FT                   TMERFLEVADQGSINRAARRLRLGQPQLSLQLANLEKFLTHRLFERQAQGSVLTEEGRR
FT                   AYQIFMAISQAWNDLKSSADERYRRTARSLRIGSIIPTGSESWVARCLGSLVSEWNARR
FT                   NNNAISLVSMTADDLREALKNGRIDVAILDSVFGLESFRHRELLQTDMVVIAPPDSTET
FT                   SVADLVAGHPICMPSPRTGLGHAAMAFSYERAPNRRRRGQDITAADSLPVIVDLVANHG
FT                   YVSFLGRVSAMPIADKVRIVDLDEHLPMSYHVAFNHRKAAADACTMIIEAAARITSEAV
FT                   VRTAAVA"
     MHLGALFIAS HVLTSGSVRE TARRFHLSPS TVSTAIHNLE TELAMTLTER ASGELAMLIA        60
     SGRVLEGLKP IMAAIGELGQ WAGHDGDGAE IDEVWASRIP VKIVTMERFL EVADQGSINR       120
     AARRLRLGQP QLSLQLANLE KFLTHRLFER QAQGSVLTEE GRRAYQIFMA ISQAWNDLKS       180
     SADERYRRTA RSLRIGSIIP TGSESWVARC LGSLVSEWNA RRNNNAISLV SMTADDLREA       240
     LKNGRIDVAI LDSVFGLESF RHRELLQTDM VVIAPPDSTE TSVADLVAGH PICMPSPRTG       300
     LGHAAMAFSY ERAPNRRRRG QDITAADSLP VIVDLVANHG YVSFLGRVSA MPIADKVRIV       360
     DLDEHLPMSY HVAFNHRKAA ADACTMIIEA AARITSEAVV RTAAVA                      406
//

If you have problems or comments...

PBIL Back to PBIL home page