(data stored in ACNUC7421 zone)

EMBL: CP001622.PE152

CP001622.PE152       Location/Qualifiers
FT   CDS             150032..150757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0153"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG:
FT                   rec:RHECIAT_CH0000559 copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54464"
FT                   /db_xref="GOA:C6AZD8"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD8"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ACS54464.1"
FT                   /translation="MTILLEVCVDSAEGLAAAIEGGAGRIELCSALELGGLTPLPSLMR
FT                   IAARAPIPVYAMIRPHAGPFIFDGADEEAMMIDIDAVRAAGLAGVVIGANRPDGTLDMP
FT                   LVHRLKAHAAGLGSTLHRAFDLVPDADQALEQAVELGCERILTSGCALKAVDGLDTLKR
FT                   ISAKAAGRIAIMPGSGIRPTNVGEILKATGAREVHGSCSSPVESADPRAVAFGFEARST
FT                   NKTDVAVVRQMRRAIEAGV"
     MTILLEVCVD SAEGLAAAIE GGAGRIELCS ALELGGLTPL PSLMRIAARA PIPVYAMIRP        60
     HAGPFIFDGA DEEAMMIDID AVRAAGLAGV VIGANRPDGT LDMPLVHRLK AHAAGLGSTL       120
     HRAFDLVPDA DQALEQAVEL GCERILTSGC ALKAVDGLDT LKRISAKAAG RIAIMPGSGI       180
     RPTNVGEILK ATGAREVHGS CSSPVESADP RAVAFGFEAR STNKTDVAVV RQMRRAIEAG       240
     V                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page