(data stored in ACNUC7421 zone)

EMBL: CP001622.PE153

CP001622.PE153       Location/Qualifiers
FT   CDS             complement(150992..152011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0154"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   rec:RHECIAT_CH0000560 probable Zn-dependent alcohol
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54465"
FT                   /db_xref="GOA:C6AZD9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD9"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS54465.1"
FT                   /translation="MKAVLCREPGVLDIVERPSPAAPAAGWVRLAVSHVGICGTDYHIF
FT                   EGKHPFLEYPRVMGHEISATVLEAGDGVTIAVGTPVIVNPYLSCGQCIACRQGKPNCCT
FT                   NIKVLGVHTDGAFCEEISVPAENLYAAKGVSLEAAATTEFLAIGAHAVRRSMTGAGARA
FT                   LVIGAGPIGLGAAIFSRIAGHEVTLLDTSTERLQMASERFGFTSGIVANEATAETVREK
FT                   TNGDGFDVVFDATGYGPSMEKAFSFVAHGGALVLVSVVKDDIRFSDPEFHKREMMVIGS
FT                   RNATRVDFEHVADSIAKGLVPVDKLITHRTTLADAPRDLARWAHEKNGLIKAVISIGG"
     MKAVLCREPG VLDIVERPSP AAPAAGWVRL AVSHVGICGT DYHIFEGKHP FLEYPRVMGH        60
     EISATVLEAG DGVTIAVGTP VIVNPYLSCG QCIACRQGKP NCCTNIKVLG VHTDGAFCEE       120
     ISVPAENLYA AKGVSLEAAA TTEFLAIGAH AVRRSMTGAG ARALVIGAGP IGLGAAIFSR       180
     IAGHEVTLLD TSTERLQMAS ERFGFTSGIV ANEATAETVR EKTNGDGFDV VFDATGYGPS       240
     MEKAFSFVAH GGALVLVSVV KDDIRFSDPE FHKREMMVIG SRNATRVDFE HVADSIAKGL       300
     VPVDKLITHR TTLADAPRDL ARWAHEKNGL IKAVISIGG                              339
//

If you have problems or comments...

PBIL Back to PBIL home page