(data stored in ACNUC7421 zone)

EMBL: CP001622.PE154

CP001622.PE154       Location/Qualifiers
FT   CDS             complement(152244..153218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0155"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_CH0000561 probable sugar ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54466"
FT                   /db_xref="GOA:C6AZE0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS54466.1"
FT                   /translation="MTATPTEIVAPPPRRKMNILFGLTLIGLLIFLWIVLGVVTPSFWT
FT                   PLNISNLLRQGAMTAILALGQTFVIITAGIDLSVGAIVGFCTVIIAWLLQAGVPVWGAI
FT                   ALTLLMGVAIGAFHGFGIVHMGLPPFIITLATLTSLRGIGLLITNGSTINITNEGFSNF
FT                   ARADLLSIPSLFWMVILVAVPSFIFLHLSRWGRYLFAVGSNAEAARLSGVNVKGMIYLA
FT                   YILSASFAAFVGVLLASRIAIGNATQADGWELQAIASSVIGGTSLFGAVGSVHGPLIGA
FT                   FILATINNGANLLNVNSFWQRIITGLLIIVIVFFDQLRRRRSN"
     MTATPTEIVA PPPRRKMNIL FGLTLIGLLI FLWIVLGVVT PSFWTPLNIS NLLRQGAMTA        60
     ILALGQTFVI ITAGIDLSVG AIVGFCTVII AWLLQAGVPV WGAIALTLLM GVAIGAFHGF       120
     GIVHMGLPPF IITLATLTSL RGIGLLITNG STINITNEGF SNFARADLLS IPSLFWMVIL       180
     VAVPSFIFLH LSRWGRYLFA VGSNAEAARL SGVNVKGMIY LAYILSASFA AFVGVLLASR       240
     IAIGNATQAD GWELQAIASS VIGGTSLFGA VGSVHGPLIG AFILATINNG ANLLNVNSFW       300
     QRIITGLLII VIVFFDQLRR RRSN                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page