(data stored in ACNUC7421 zone)

EMBL: CP001622.PE155

CP001622.PE155       Location/Qualifiers
FT   CDS             complement(153246..154799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0156"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_CH00491 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54467"
FT                   /db_xref="GOA:C6AZE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54467.1"
FT                   /translation="MIGLEEVSHRHDDSATLKEANRIPAGSPILELKGLQKNYGHVQAL
FT                   KPATLTFLAGEIHAIVGENGAGKSTLIKLLTGVITRTAGEVLWCGQPVGLATPNEAIAR
FT                   GINAVHQEVVLCRHLTVAANLFLGDEVNRFGLMRKKQMEKMAQAVLDDLGFGLPAGALL
FT                   SSLTIGQQQLVATARAAMRGTQFLIFDEPTAYLTRQESAQLFKLIRRLQGEGVTIVYIS
FT                   HRMEEVFELADRVSVLRDGTHVGTRLIGETNDAELISLMINRSIEQIYHKEKIAIGETI
FT                   LTVNGLSGPGFEDVSLSVKAGQIVGLYGLIGAGRSEFALGLYGRQPTTAGDVEWMGKRV
FT                   DIRNERTAMELGIALAPESRRDQGLCLNLPIGLNINLPVFGRLSHGPVINHTRESANAD
FT                   QQIRNLSIKTPSRRVPASSMSGGNQQKIVIGKWLSHGARLFIFDEPTVGVDVGTKAEIY
FT                   RLFAKLLKDGAGIILISSYLPEVYELADRLHVFRAGKIVASHDYHAATHEEVLSEAIGV
FT                   "
     MIGLEEVSHR HDDSATLKEA NRIPAGSPIL ELKGLQKNYG HVQALKPATL TFLAGEIHAI        60
     VGENGAGKST LIKLLTGVIT RTAGEVLWCG QPVGLATPNE AIARGINAVH QEVVLCRHLT       120
     VAANLFLGDE VNRFGLMRKK QMEKMAQAVL DDLGFGLPAG ALLSSLTIGQ QQLVATARAA       180
     MRGTQFLIFD EPTAYLTRQE SAQLFKLIRR LQGEGVTIVY ISHRMEEVFE LADRVSVLRD       240
     GTHVGTRLIG ETNDAELISL MINRSIEQIY HKEKIAIGET ILTVNGLSGP GFEDVSLSVK       300
     AGQIVGLYGL IGAGRSEFAL GLYGRQPTTA GDVEWMGKRV DIRNERTAME LGIALAPESR       360
     RDQGLCLNLP IGLNINLPVF GRLSHGPVIN HTRESANADQ QIRNLSIKTP SRRVPASSMS       420
     GGNQQKIVIG KWLSHGARLF IFDEPTVGVD VGTKAEIYRL FAKLLKDGAG IILISSYLPE       480
     VYELADRLHV FRAGKIVASH DYHAATHEEV LSEAIGV                                517
//

If you have problems or comments...

PBIL Back to PBIL home page