(data stored in ACNUC7421 zone)

EMBL: CP001622.PE156

CP001622.PE156       Location/Qualifiers
FT   CDS             complement(154908..155897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0157"
FT                   /product="sugar ABC transporter, substrate-binding protein"
FT                   /note="KEGG: ret:RHE_CH00492 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54468"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE2"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00492"
FT                   /protein_id="ACS54468.1"
FT                   /translation="MSFVKSLLSRRAFTALAGAAVIASAMPAPSFAADVTIPIIVKDTT
FT                   SFYWQIVLAGARKAGKDLGVNVPELGAQAESDVNGQISILENAVAGKPAAVVISPTEFK
FT                   ALGKPIDEAAKSVPIIGIDSGADSKAFKSFLTTDNVQGGRIAADGLAAAIKGATGKEEG
FT                   EIVILTNLPGVGSLEQRREGFLDQVKTKYPGLKVIADKYGDGQATTGLNMMTDLITANP
FT                   NLVGIFASNLIMAQGVGQAIAENKLGEKIKVIGFDSDDKTVGFLKDGAIAGLVVQDPYR
FT                   MGYDGVKTALAVSKGEKVEENVDTGANLVTKANMADPKIDALLNPKIK"
     MSFVKSLLSR RAFTALAGAA VIASAMPAPS FAADVTIPII VKDTTSFYWQ IVLAGARKAG        60
     KDLGVNVPEL GAQAESDVNG QISILENAVA GKPAAVVISP TEFKALGKPI DEAAKSVPII       120
     GIDSGADSKA FKSFLTTDNV QGGRIAADGL AAAIKGATGK EEGEIVILTN LPGVGSLEQR       180
     REGFLDQVKT KYPGLKVIAD KYGDGQATTG LNMMTDLITA NPNLVGIFAS NLIMAQGVGQ       240
     AIAENKLGEK IKVIGFDSDD KTVGFLKDGA IAGLVVQDPY RMGYDGVKTA LAVSKGEKVE       300
     ENVDTGANLV TKANMADPKI DALLNPKIK                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page