(data stored in ACNUC7421 zone)

EMBL: CP001622.PE158

CP001622.PE158       Location/Qualifiers
FT   CDS             complement(156562..157581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0159"
FT                   /product="Pyridoxal 4-dehydrogenase"
FT                   /EC_number="1.1.1.107"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000565 putative L-fucose dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54470"
FT                   /db_xref="GOA:C6AZE4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE4"
FT                   /inference="protein motif:PRIAM:1.1.1.107"
FT                   /protein_id="ACS54470.1"
FT                   /translation="MKTRQIGKTKLEVTEISFGAAALGGLYRACPREVAMDTLQAAWDS
FT                   GIRYFDVAPWYGLGLAERRVGDFLRDQPDGSYVLSTKVGRLLRPVPTGTVPDYSYVDPL
FT                   SFDADYDYSYDGIMRSVEFSYARLGLNRIDILYVHDLGVYTHGAAKNAVHQKQFLDSGV
FT                   KALEELKSSGAISAFGLGVNEVPVCLDVMRHSDLDCILMAGRYTLLDRSAVAELLPLCR
FT                   QKGTSLVVGGVFNSGILATGPVPGSHFDYMPADDDVLAKVGAMEAIAKRHGVPLAAPAL
FT                   QFPLREPIVASVLIGTAKPSSLTRNMEIVEPRLADAIYAEFEPYTLVAPPLGAEAVRV"
     MKTRQIGKTK LEVTEISFGA AALGGLYRAC PREVAMDTLQ AAWDSGIRYF DVAPWYGLGL        60
     AERRVGDFLR DQPDGSYVLS TKVGRLLRPV PTGTVPDYSY VDPLSFDADY DYSYDGIMRS       120
     VEFSYARLGL NRIDILYVHD LGVYTHGAAK NAVHQKQFLD SGVKALEELK SSGAISAFGL       180
     GVNEVPVCLD VMRHSDLDCI LMAGRYTLLD RSAVAELLPL CRQKGTSLVV GGVFNSGILA       240
     TGPVPGSHFD YMPADDDVLA KVGAMEAIAK RHGVPLAAPA LQFPLREPIV ASVLIGTAKP       300
     SSLTRNMEIV EPRLADAIYA EFEPYTLVAP PLGAEAVRV                              339
//

If you have problems or comments...

PBIL Back to PBIL home page