(data stored in ACNUC7421 zone)

EMBL: CP001622.PE159

CP001622.PE159       Location/Qualifiers
FT   CDS             complement(157727..159229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0160"
FT                   /product="Galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG:
FT                   rec:RHECIAT_CH0000566 probable altronate dehydratase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54471"
FT                   /db_xref="GOA:C6AZE5"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE5"
FT                   /inference="protein motif:PRIAM:4.2.1.42"
FT                   /protein_id="ACS54471.1"
FT                   /translation="MDKLPWIILSAGDNVAVATAAIAPGSTVAGIQTREKIDPGHKVAI
FT                   ADIPLGGPVVKYGQAIGRTTAEVKAGDHVHSHNLHFENDRLAATANSAPEAATADDVGR
FT                   TFMGYRRADGRAATRNYIGIIASVNCSTTVCRAIADEANRTILPHYEGIDGFVPIVHDQ
FT                   GCGMSSTGDGMNVLHRTLAGYTRHVNFGGVLMIGLGCEVNQLTLYGQSGAGASKRHFNI
FT                   QDAGGSRRAVERAMGMLREIAADVGKEKRVPMSIGEIIIGLQCGGSDGFSGITANPALG
FT                   VAADLLAAAGGTAILSETSEIYGAEHLLRSRAVSDEVAKKLDDKIAWWEDYVALHGASL
FT                   DNNPSPGNKRGGLTTILEKSLGAVAKGGRSPLTAVYGYAERVTAPGLVFMDTPGYDPVS
FT                   ATGQVAGGANMIAFTTGRGSCFGCRPAPSLKLSSNSALYASMEEDMDIDCGTIATGDAT
FT                   ISGKGREIFDLIVDTASGKKTKSELFGYGDNEFVPWHLGATL"
     MDKLPWIILS AGDNVAVATA AIAPGSTVAG IQTREKIDPG HKVAIADIPL GGPVVKYGQA        60
     IGRTTAEVKA GDHVHSHNLH FENDRLAATA NSAPEAATAD DVGRTFMGYR RADGRAATRN       120
     YIGIIASVNC STTVCRAIAD EANRTILPHY EGIDGFVPIV HDQGCGMSST GDGMNVLHRT       180
     LAGYTRHVNF GGVLMIGLGC EVNQLTLYGQ SGAGASKRHF NIQDAGGSRR AVERAMGMLR       240
     EIAADVGKEK RVPMSIGEII IGLQCGGSDG FSGITANPAL GVAADLLAAA GGTAILSETS       300
     EIYGAEHLLR SRAVSDEVAK KLDDKIAWWE DYVALHGASL DNNPSPGNKR GGLTTILEKS       360
     LGAVAKGGRS PLTAVYGYAE RVTAPGLVFM DTPGYDPVSA TGQVAGGANM IAFTTGRGSC       420
     FGCRPAPSLK LSSNSALYAS MEEDMDIDCG TIATGDATIS GKGREIFDLI VDTASGKKTK       480
     SELFGYGDNE FVPWHLGATL                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page