(data stored in ACNUC7421 zone)

EMBL: CP001622.PE16

CP001622.PE16        Location/Qualifiers
FT   CDS             complement(13371..13787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0016"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: ret:RHE_CH00371
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54328"
FT                   /db_xref="GOA:C6AYA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS54328.1"
FT                   /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISNILNVPVSFFFEDAPGEHSNAGGGMETSSSNYVVDFLSSSE
FT                   GLQLNRAFVKISDPKVRRKVVELVKALAAEADAD"
     MIENKKKPNP IDIHVGSRIR LRRTMLGMSQ EKLGESLGIT FQQIQKYEKG TNRVGASRLQ        60
     NISNILNVPV SFFFEDAPGE HSNAGGGMET SSSNYVVDFL SSSEGLQLNR AFVKISDPKV       120
     RRKVVELVKA LAAEADAD                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page