(data stored in ACNUC7421 zone)

EMBL: CP001622.PE160

CP001622.PE160       Location/Qualifiers
FT   CDS             159454..160353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0161"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; KEGG: rec:RHECIAT_CH0000567 probable transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54472"
FT                   /db_xref="GOA:C6AZE6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE6"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS54472.1"
FT                   /translation="MARQNTVFKEAYNRYAVALRTDTALPSEPEIAAQLGVSRSTARAI
FT                   LTRLSEEGIIRWNKRQKIVLRQPTDHDLFPSEETDSLHDIIERSFMQRILADDAAPGMQ
FT                   INELELAREIGTGTTSVREFLIRFSRFGLIEKRPNSHWTLKGFTREFALELADVREMFE
FT                   LHSAAEFGRLPRDNQSWADLAAMRDEHHAMLADINQRFKDFSVLDERFHLLIHRASKNR
FT                   FIADFYDAIAIVFHYHYQWNKAAARQRNERAIHEHLDYIAALESGDQPAIETACRAHLH
FT                   SARQTLLQSLPQVATENA"
     MARQNTVFKE AYNRYAVALR TDTALPSEPE IAAQLGVSRS TARAILTRLS EEGIIRWNKR        60
     QKIVLRQPTD HDLFPSEETD SLHDIIERSF MQRILADDAA PGMQINELEL AREIGTGTTS       120
     VREFLIRFSR FGLIEKRPNS HWTLKGFTRE FALELADVRE MFELHSAAEF GRLPRDNQSW       180
     ADLAAMRDEH HAMLADINQR FKDFSVLDER FHLLIHRASK NRFIADFYDA IAIVFHYHYQ       240
     WNKAAARQRN ERAIHEHLDY IAALESGDQP AIETACRAHL HSARQTLLQS LPQVATENA        299
//

If you have problems or comments...

PBIL Back to PBIL home page