(data stored in ACNUC7421 zone)

EMBL: CP001622.PE161

CP001622.PE161       Location/Qualifiers
FT   CDS             160617..161735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0162"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecl:EcolC_3640 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54473"
FT                   /db_xref="GOA:C6AUF2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C6AUF2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACS54473.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPAGFDLEATARLRGAFTRVREIKNAET
FT                   LLRLALAYGGLGMSLRETCAWAEAGGIARLSDPSLLERLCKAAPWLGDIVAALIAEQAK
FT                   VPTGRFAGYRLRVLDGTSICHPGADRTTWRLHVGYDLATAQVDQLELTDIHGAENLQRL
FT                   TYAPGDIVLADRYYARPRDLRPVIDAGADFIVRTGWNSLRLLQTNGEPFDLFAALAAQQ
FT                   EQEGEVQVRVHEGMTGTPPPPPLVLRLIVRRKDPQQAQAEQERLLKDARKRGKKPDPRS
FT                   LEAAKYILLLTSLPTATFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARA
FT                   WLYARLIVAIIAEQIAGQVPDSPPSGCGNPTG"
     MKIRPEVLDH WPEVRERLPA GFDLEATARL RGAFTRVREI KNAETLLRLA LAYGGLGMSL        60
     RETCAWAEAG GIARLSDPSL LERLCKAAPW LGDIVAALIA EQAKVPTGRF AGYRLRVLDG       120
     TSICHPGADR TTWRLHVGYD LATAQVDQLE LTDIHGAENL QRLTYAPGDI VLADRYYARP       180
     RDLRPVIDAG ADFIVRTGWN SLRLLQTNGE PFDLFAALAA QQEQEGEVQV RVHEGMTGTP       240
     PPPPLVLRLI VRRKDPQQAQ AEQERLLKDA RKRGKKPDPR SLEAAKYILL LTSLPTATFP       300
     PADILTLYRF RWQIELAFKR FKSLAGLDSL PAKKPELARA WLYARLIVAI IAEQIAGQVP       360
     DSPPSGCGNP TG                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page