(data stored in ACNUC7421 zone)

EMBL: CP001622.PE162

CP001622.PE162       Location/Qualifiers
FT   CDS             162020..164020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0163"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   domain protein; SbmABacA family protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000570 probable ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54474"
FT                   /db_xref="GOA:C6AZE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54474.1"
FT                   /translation="MADAKLKPKSVDGTEPHGAGNSPQETASTVEVMPPPDAIEPDPEL
FT                   TPEEAEQARKRYLLKRFWISARRYWGRGGDKFAWPFSIGLLALIGMNVGFQYGINLWNR
FT                   GIFDAIERHDAGTVYFLTAVFVPLVLGTVAIVTIQVAVRMMIQRRWRSWLTTSVIARWL
FT                   ANGRYYQLNLIGGDHKNPEARISEDLRIATEAPVDFIAGVISAFLAASTFIVVLWTIGG
FT                   ALTLPIAGFPVTIPGFLVVTAVLYAAITSTSMAVIGRYFVHVSEAKNQAEAEFRYTLTH
FT                   VRENGESIALLGGEEEERNDLDKTFANVLRQWALLARQHMRTTLVSHGSMLIAPVVPVL
FT                   LCAPKFLEGSMSLGQVMQAASAFAIVQGAFGWLVDNYPRLADWNACARRIASLMMSLDG
FT                   LERAEQSDSLGRIKHGETEGEAMLSLNDLSVSLDDGTAVVTETRVEIEPGERVLVSGES
FT                   GSGKSTLVRAIAGLWPWGGGSVNFHADRRLFMLPQRPYIPSGTLRRAVAYPGAADSWPL
FT                   DEIKAALDKVGLDYLNDKIEEDAPWDQTLSGGEKQRLAFARLLLHQPDIIVLDEATAAL
FT                   DEKSQDKMMQMVIDELPEVTILSVAHRAELEVFHSRKITLERREGGAKLVSDIDLIKRK
FT                   RKRNLLSRVLEKRRSPPKGSTTANEGGTVPE"
     MADAKLKPKS VDGTEPHGAG NSPQETASTV EVMPPPDAIE PDPELTPEEA EQARKRYLLK        60
     RFWISARRYW GRGGDKFAWP FSIGLLALIG MNVGFQYGIN LWNRGIFDAI ERHDAGTVYF       120
     LTAVFVPLVL GTVAIVTIQV AVRMMIQRRW RSWLTTSVIA RWLANGRYYQ LNLIGGDHKN       180
     PEARISEDLR IATEAPVDFI AGVISAFLAA STFIVVLWTI GGALTLPIAG FPVTIPGFLV       240
     VTAVLYAAIT STSMAVIGRY FVHVSEAKNQ AEAEFRYTLT HVRENGESIA LLGGEEEERN       300
     DLDKTFANVL RQWALLARQH MRTTLVSHGS MLIAPVVPVL LCAPKFLEGS MSLGQVMQAA       360
     SAFAIVQGAF GWLVDNYPRL ADWNACARRI ASLMMSLDGL ERAEQSDSLG RIKHGETEGE       420
     AMLSLNDLSV SLDDGTAVVT ETRVEIEPGE RVLVSGESGS GKSTLVRAIA GLWPWGGGSV       480
     NFHADRRLFM LPQRPYIPSG TLRRAVAYPG AADSWPLDEI KAALDKVGLD YLNDKIEEDA       540
     PWDQTLSGGE KQRLAFARLL LHQPDIIVLD EATAALDEKS QDKMMQMVID ELPEVTILSV       600
     AHRAELEVFH SRKITLERRE GGAKLVSDID LIKRKRKRNL LSRVLEKRRS PPKGSTTANE       660
     GGTVPE                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page