(data stored in ACNUC7421 zone)

EMBL: CP001622.PE163

CP001622.PE163       Location/Qualifiers
FT   CDS             complement(164047..164505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0164"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cak:Caul_1741 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54475"
FT                   /db_xref="GOA:C6AZE9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS54475.1"
FT                   /translation="MDDDVLSTPGHLVSLAARGFARLSESRLKPLGFGVGQLPVLVALQ
FT                   DGKASTQRDLARFARIEQPPMAQMLARMERDGLIKRTRDPADRRSSRIVLTKTAQERMP
FT                   KAIAALFQGNREALAGFTDAEAGQLADLLTRLIDNLDQIASAEPSSGV"
     MDDDVLSTPG HLVSLAARGF ARLSESRLKP LGFGVGQLPV LVALQDGKAS TQRDLARFAR        60
     IEQPPMAQML ARMERDGLIK RTRDPADRRS SRIVLTKTAQ ERMPKAIAAL FQGNREALAG       120
     FTDAEAGQLA DLLTRLIDNL DQIASAEPSS GV                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page