(data stored in ACNUC7421 zone)

EMBL: CP001622.PE164

CP001622.PE164       Location/Qualifiers
FT   CDS             164633..165010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_1742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54476"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF0"
FT                   /inference="similar to AA sequence:KEGG:Caul_1742"
FT                   /protein_id="ACS54476.1"
FT                   /translation="MSQNDVEMIKRIYASFNARDIDAVLAVLSDDVAWANGMDGGHVHG
FT                   REAVRDYWTRQWAVISPHVEPVAFEETPDGAIAVEVIQSVFDLDGRPLEGRAHGLKDKT
FT                   VTHIFRMQGDKIVRFDIRDAL"
     MSQNDVEMIK RIYASFNARD IDAVLAVLSD DVAWANGMDG GHVHGREAVR DYWTRQWAVI        60
     SPHVEPVAFE ETPDGAIAVE VIQSVFDLDG RPLEGRAHGL KDKTVTHIFR MQGDKIVRFD       120
     IRDAL                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page