(data stored in ACNUC7421 zone)

EMBL: CP001622.PE165

CP001622.PE165       Location/Qualifiers
FT   CDS             complement(165149..165400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54477"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54477.1"
FT                   /translation="MQSSCMHQPWRKKIIKIMVLLHSADGMAWQSPPKGTSLKTLSEAE
FT                   EQGFILIRGEFQKRQFRLTELGSNYVERDKRRLEARRL"
     MQSSCMHQPW RKKIIKIMVL LHSADGMAWQ SPPKGTSLKT LSEAEEQGFI LIRGEFQKRQ        60
     FRLTELGSNY VERDKRRLEA RRL                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page