(data stored in ACNUC7421 zone)

EMBL: CP001622.PE166

CP001622.PE166       Location/Qualifiers
FT   CDS             165675..166520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0167"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   reh:H16_A2216 SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54478"
FT                   /db_xref="GOA:C6AZF2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS54478.1"
FT                   /translation="MSANLDDIRNHQRETWDKFSAGWKKWDSLVLSWLAPFGDAMLRRA
FT                   NLSNGFNVLDIAAGTGEPGLTAAAAIPEGHVVVTDLSENMLTAAAENAARRGLKNFETR
FT                   LCDAGTLPFADASFDAVLCRFGFMFFPDIAAAAKEMARVAEPGARVSAAVWSAPAKNPW
FT                   ATTIMGTIARHVDISAPPPGSPGLFRCAGEGMMVETFKEAGLLDVAEEEVSAMMVHDTP
FT                   ARYWDFMTEVAAPVVAGLSRADAATREKIRGEVLELALQSVSDGKVYLRSTATVITGTR
FT                   "
     MSANLDDIRN HQRETWDKFS AGWKKWDSLV LSWLAPFGDA MLRRANLSNG FNVLDIAAGT        60
     GEPGLTAAAA IPEGHVVVTD LSENMLTAAA ENAARRGLKN FETRLCDAGT LPFADASFDA       120
     VLCRFGFMFF PDIAAAAKEM ARVAEPGARV SAAVWSAPAK NPWATTIMGT IARHVDISAP       180
     PPGSPGLFRC AGEGMMVETF KEAGLLDVAE EEVSAMMVHD TPARYWDFMT EVAAPVVAGL       240
     SRADAATREK IRGEVLELAL QSVSDGKVYL RSTATVITGT R                           281
//

If you have problems or comments...

PBIL Back to PBIL home page