(data stored in ACNUC7421 zone)

EMBL: CP001622.PE167

CP001622.PE167       Location/Qualifiers
FT   CDS             complement(166709..167284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54479"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PC0000028"
FT                   /protein_id="ACS54479.1"
FT                   /translation="MSVFVLLLGFPGVGKLTIAKELGSLISAKVVDNHWFNNPILRLLD
FT                   EEGTAPLPKGIWEYTGRVRQAVLDAITAYSGPSANFIFTHAGVEGDERSTRTYEQFVEA
FT                   ARQRAAVFVPVRLLCAEEELARRVSAPARRDHLKTTDVETSRSRSQQAVVLNIPHQHAL
FT                   TLDVTLTSPLESAAALRDHVVTCLPNGR"
     MSVFVLLLGF PGVGKLTIAK ELGSLISAKV VDNHWFNNPI LRLLDEEGTA PLPKGIWEYT        60
     GRVRQAVLDA ITAYSGPSAN FIFTHAGVEG DERSTRTYEQ FVEAARQRAA VFVPVRLLCA       120
     EEELARRVSA PARRDHLKTT DVETSRSRSQ QAVVLNIPHQ HALTLDVTLT SPLESAAALR       180
     DHVVTCLPNG R                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page