(data stored in ACNUC7421 zone)

EMBL: CP001622.PE168

CP001622.PE168       Location/Qualifiers
FT   CDS             complement(167359..168849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0169"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00498 putative multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54480"
FT                   /db_xref="GOA:C6AZF4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54480.1"
FT                   /translation="MSNAAQRSNRVLIVATIMLATFMVAIEATIVATAMPRIVGELGGF
FT                   SYYSWVFSAFLLAQSTTTVIYGKLSDIFGRKPVLIGGILIFLVGSLLCGLAWSMMSLVL
FT                   FRLLQGLGAGAIQPVTTTIIGDLFKLEERGRVQGFMATVWATSAVVGPLAGGIIVDNIS
FT                   WAWIFWINLPIGVISIIAFMVFLKEDVAHKQAKIDYLGSVLFSISIVALLVMLTETDAS
FT                   AWILISLFAVFVIAGILFLAQEKRAPEPIISIPLWSRRLIATSNAATLLAGMALIGLST
FT                   ILPLYVQGVLGRSPLVAGFTLTMLVVGWPLAVMLSGRFYRAFGIQRTLRVGSLMFPFGA
FT                   CFLLFLTQESSPIVAGAGSFFMGFGMGLISLTSIVLVQDSVEWSMRGSATASIIFSRSL
FT                   GNTLGATVLGAILNAGINHYASGEAAAGLHEALNQPTGLSALAADPAIRSIFNAALHWS
FT                   FWGVVVVAVLTFFTTWLIPVGPSQKREGTAVASEAASH"
     MSNAAQRSNR VLIVATIMLA TFMVAIEATI VATAMPRIVG ELGGFSYYSW VFSAFLLAQS        60
     TTTVIYGKLS DIFGRKPVLI GGILIFLVGS LLCGLAWSMM SLVLFRLLQG LGAGAIQPVT       120
     TTIIGDLFKL EERGRVQGFM ATVWATSAVV GPLAGGIIVD NISWAWIFWI NLPIGVISII       180
     AFMVFLKEDV AHKQAKIDYL GSVLFSISIV ALLVMLTETD ASAWILISLF AVFVIAGILF       240
     LAQEKRAPEP IISIPLWSRR LIATSNAATL LAGMALIGLS TILPLYVQGV LGRSPLVAGF       300
     TLTMLVVGWP LAVMLSGRFY RAFGIQRTLR VGSLMFPFGA CFLLFLTQES SPIVAGAGSF       360
     FMGFGMGLIS LTSIVLVQDS VEWSMRGSAT ASIIFSRSLG NTLGATVLGA ILNAGINHYA       420
     SGEAAAGLHE ALNQPTGLSA LAADPAIRSI FNAALHWSFW GVVVVAVLTF FTTWLIPVGP       480
     SQKREGTAVA SEAASH                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page