(data stored in ACNUC7421 zone)

EMBL: CP001622.PE169

CP001622.PE169       Location/Qualifiers
FT   CDS             complement(169109..169504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54481"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF5"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00499"
FT                   /protein_id="ACS54481.1"
FT                   /translation="MPCKFIAISLLSIGLAGPALAQTAGGADANGRLSVAPIIGGSGSS
FT                   GAGSAGAGSAGTGSVGGGATGTGSVGTGSVGTDSGTTGSTTGNGGVNLNSGRSTINPGG
FT                   VNPNLQQTPGCTSGSADTGSRGEACPQ"
     MPCKFIAISL LSIGLAGPAL AQTAGGADAN GRLSVAPIIG GSGSSGAGSA GAGSAGTGSV        60
     GGGATGTGSV GTGSVGTDSG TTGSTTGNGG VNLNSGRSTI NPGGVNPNLQ QTPGCTSGSA       120
     DTGSRGEACP Q                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page