(data stored in ACNUC7421 zone)

EMBL: CP001622.PE17

CP001622.PE17        Location/Qualifiers
FT   CDS             complement(13939..15543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0017"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rec:RHECIAT_CH0000412
FT                   apolipoprotein N-acyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54329"
FT                   /db_xref="GOA:C6AYA5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA5"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACS54329.1"
FT                   /translation="MERLADRVILVWGFKRSLLAIAAGAFAVLALPPIGFFAAMFVSFT
FT                   LLVWLIDGAAASPESGLIGRLWPAFATGWLFGFGYFVAGLWWVGHALLVDQEEFAWALP
FT                   LAILGLPACLAIFYGLAAALARIFWSDGMGRIAALAAGFGLMEWLRSVILTGFPWNAIG
FT                   YGMMPVPLMMQSAHLIGAMGVTALAVFVFSAPALAGTRQGARPGIALAVLLFAAHLGYG
FT                   AYALHLAPRPDILPEDKRPVVRLVQPAIDQTEKMDNDVDRATIFETHLKLSAEAPKNGG
FT                   RKPDIIVWPETSIPFILTDNQDALTRIADTLDDNQILIAGAVRAEEMGPGTPPRYYNSI
FT                   YVIDGRGQIIAASDKVHLVPFGEYLPFEDVLTEFGIQNVVEVPGGFSAAASRHLLALPG
FT                   GLNLYPLICYEIIFPGEMTGDIKDANAILNITNDAWFGLTPGPYQHFQQARVRAVETGL
FT                   PLIRDANNGISALVNAHGEIIAGLDLGETGFVDATLDSIGAGLGTTIPRQTYFWLTEAL
FT                   LILIALISRRGFISGLN"
     MERLADRVIL VWGFKRSLLA IAAGAFAVLA LPPIGFFAAM FVSFTLLVWL IDGAAASPES        60
     GLIGRLWPAF ATGWLFGFGY FVAGLWWVGH ALLVDQEEFA WALPLAILGL PACLAIFYGL       120
     AAALARIFWS DGMGRIAALA AGFGLMEWLR SVILTGFPWN AIGYGMMPVP LMMQSAHLIG       180
     AMGVTALAVF VFSAPALAGT RQGARPGIAL AVLLFAAHLG YGAYALHLAP RPDILPEDKR       240
     PVVRLVQPAI DQTEKMDNDV DRATIFETHL KLSAEAPKNG GRKPDIIVWP ETSIPFILTD       300
     NQDALTRIAD TLDDNQILIA GAVRAEEMGP GTPPRYYNSI YVIDGRGQII AASDKVHLVP       360
     FGEYLPFEDV LTEFGIQNVV EVPGGFSAAA SRHLLALPGG LNLYPLICYE IIFPGEMTGD       420
     IKDANAILNI TNDAWFGLTP GPYQHFQQAR VRAVETGLPL IRDANNGISA LVNAHGEIIA       480
     GLDLGETGFV DATLDSIGAG LGTTIPRQTY FWLTEALLIL IALISRRGFI SGLN             534
//

If you have problems or comments...

PBIL Back to PBIL home page