(data stored in ACNUC7421 zone)

EMBL: CP001622.PE170

CP001622.PE170       Location/Qualifiers
FT   CDS             complement(169728..170051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0171"
FT                   /product="addiction module antidote protein"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   rru:Rru_A3082 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54482"
FT                   /db_xref="GOA:C6AZF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF6"
FT                   /inference="protein motif:TFAM:TIGR02684"
FT                   /protein_id="ACS54482.1"
FT                   /translation="MALEIIPFDATEFLDTEESQAHLIEDAFESGDAGYIAHALGVVAK
FT                   ARGMSQVARDAGVTREALYKSLSEKGDPKLSTLIGVAAALGYKLTATRVGDSDTREDER
FT                   RSA"
     MALEIIPFDA TEFLDTEESQ AHLIEDAFES GDAGYIAHAL GVVAKARGMS QVARDAGVTR        60
     EALYKSLSEK GDPKLSTLIG VAAALGYKLT ATRVGDSDTR EDERRSA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page