(data stored in ACNUC7421 zone)

EMBL: CP001622.PE171

CP001622.PE171       Location/Qualifiers
FT   CDS             complement(170053..170418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0172"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: btr:Btr_1092
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54483"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF7"
FT                   /inference="protein motif:TFAM:TIGR02683"
FT                   /protein_id="ACS54483.1"
FT                   /translation="MTGGPSQHSGQQKVDYSREGVNYSSRKYTVLQTAEFQKWLRKLKD
FT                   RNARDRIVTRIVRAEAGNLGDHKFFDGIGELRLDYGPGYRLYFAMQGSVVVILLCGGDK
FT                   GSQERDIKRAIEMSKEI"
     MTGGPSQHSG QQKVDYSREG VNYSSRKYTV LQTAEFQKWL RKLKDRNARD RIVTRIVRAE        60
     AGNLGDHKFF DGIGELRLDY GPGYRLYFAM QGSVVVILLC GGDKGSQERD IKRAIEMSKE       120
     I                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page