(data stored in ACNUC7421 zone)

EMBL: CP001622.PE172

CP001622.PE172       Location/Qualifiers
FT   CDS             complement(170415..170888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54484"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54484.1"
FT                   /translation="MRTSLLSIALFTFSLSAAQAADFPLASCAGWNGTLVSRTGTDSST
FT                   AIMKGKVTQADFREYCERDPGGETTAHGGKLTVKQCVATYTKANGKDTYRSTANCIEGT
FT                   LSFVPPRGEPLRVTFPLPEDADVSCASGMPPLIEQFKLLCPQAAREFHLMDDE"
     MRTSLLSIAL FTFSLSAAQA ADFPLASCAG WNGTLVSRTG TDSSTAIMKG KVTQADFREY        60
     CERDPGGETT AHGGKLTVKQ CVATYTKANG KDTYRSTANC IEGTLSFVPP RGEPLRVTFP       120
     LPEDADVSCA SGMPPLIEQF KLLCPQAARE FHLMDDE                                157
//

If you have problems or comments...

PBIL Back to PBIL home page