(data stored in ACNUC7421 zone)

EMBL: CP001622.PE173

CP001622.PE173       Location/Qualifiers
FT   CDS             complement(171262..172221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0174"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rec:RHECIAT_CH0000578 probable dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54485"
FT                   /db_xref="GOA:C6AZF9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF9"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACS54485.1"
FT                   /translation="MALPPILKDRLRLPVIGSPLFIISHPALTLAQCKAGIVGAFPALN
FT                   VRPESQLDEWLAEITEELARHDAAHPERPAAPFAVNQIVHMSNKRLEHDLSLCVKYKVP
FT                   IVISSLGAVPEVNAAVHSYGGIVLHDIINNRHAHSAIRKGADGLIAVAAGAGGHAGTLS
FT                   PFALVQEIREWFDGPLLLAGAIATGGAILAAEAMGADMAYIGSPFIATEEARAAAAYKQ
FT                   AIVEGAASDIVYSNYFTGVHGNYLKPSILAAGMDPDNLPLADVSKMDFEQAVGGAKAWK
FT                   DIWGSGQGISAVKAVEPVAKLVDRLEAEYRAARTRLAL"
     MALPPILKDR LRLPVIGSPL FIISHPALTL AQCKAGIVGA FPALNVRPES QLDEWLAEIT        60
     EELARHDAAH PERPAAPFAV NQIVHMSNKR LEHDLSLCVK YKVPIVISSL GAVPEVNAAV       120
     HSYGGIVLHD IINNRHAHSA IRKGADGLIA VAAGAGGHAG TLSPFALVQE IREWFDGPLL       180
     LAGAIATGGA ILAAEAMGAD MAYIGSPFIA TEEARAAAAY KQAIVEGAAS DIVYSNYFTG       240
     VHGNYLKPSI LAAGMDPDNL PLADVSKMDF EQAVGGAKAW KDIWGSGQGI SAVKAVEPVA       300
     KLVDRLEAEY RAARTRLAL                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page