(data stored in ACNUC7421 zone)

EMBL: CP001622.PE174

CP001622.PE174       Location/Qualifiers
FT   CDS             172508..173692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0175"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000580 putative transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54486"
FT                   /db_xref="GOA:C6AZG0"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000580"
FT                   /protein_id="ACS54486.1"
FT                   /translation="MSGLETAIRTALENSDRDNPEVRARIYQSARQALEAGLRKQDITD
FT                   TEVVAHHRHRLESTIHAIEGEERDRLHPRQRPPEVPVPPVVEMPAPPVHQAEADEFDGP
FT                   MVSGETRAPEVMHRGDESSLDDVHAGNTDHLAAAPVGEERLARGQRATNMDFRPERAAG
FT                   RRKPRKFFSRLLVWCVLLAFIGIGAWWAHTSGLLMTAAERDTSVANPPASTQPEDFTGN
FT                   DDSAGNAASHTDEPVTIDPQNSFSADWIPLFKPEDADKIQSGPRARTEKIAENDGPAVR
FT                   LISESGAADGNVSISVPPSVLQQLAGKSSTIALTLQSTTDEPTQITVECNFQTLGNCAR
FT                   HRFTVTREKSDALLQVKFDRSLAPNSPGTLTINSDLDGKARGINLFAIRILPGQ"
     MSGLETAIRT ALENSDRDNP EVRARIYQSA RQALEAGLRK QDITDTEVVA HHRHRLESTI        60
     HAIEGEERDR LHPRQRPPEV PVPPVVEMPA PPVHQAEADE FDGPMVSGET RAPEVMHRGD       120
     ESSLDDVHAG NTDHLAAAPV GEERLARGQR ATNMDFRPER AAGRRKPRKF FSRLLVWCVL       180
     LAFIGIGAWW AHTSGLLMTA AERDTSVANP PASTQPEDFT GNDDSAGNAA SHTDEPVTID       240
     PQNSFSADWI PLFKPEDADK IQSGPRARTE KIAENDGPAV RLISESGAAD GNVSISVPPS       300
     VLQQLAGKSS TIALTLQSTT DEPTQITVEC NFQTLGNCAR HRFTVTREKS DALLQVKFDR       360
     SLAPNSPGTL TINSDLDGKA RGINLFAIRI LPGQ                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page