(data stored in ACNUC7421 zone)

EMBL: CP001622.PE175

CP001622.PE175       Location/Qualifiers
FT   CDS             complement(173746..174627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0176"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ret:RHE_CH00507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54487"
FT                   /db_xref="GOA:C6AZG1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG1"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACS54487.1"
FT                   /translation="MDEDIENRAVELEIRGKKRTFDVDDPALPNWVDEHALESGDFPYK
FT                   KKLKEEDYLEELEKLQIELVKVQFWLQATGKRVMALFEGRDAAGKGGAISASSAHMNPR
FT                   LARVVALTKPTEREQGQWYFQRYVAQFPTAGEFVLFDRSWYNRAGVEPVMGFCTPQQYE
FT                   DFLKQTPQLEKIIAHEGIFFFKFYLDIGREMQLKRFHDRRHDPLKVWKLSSMDIAALTK
FT                   WGDYSEKRDRMLKETHTDFAPWTVIRANDKRRARLELIRHMLNKMDYDGKDKKALGTVD
FT                   EEIIGSGLGFLK"
     MDEDIENRAV ELEIRGKKRT FDVDDPALPN WVDEHALESG DFPYKKKLKE EDYLEELEKL        60
     QIELVKVQFW LQATGKRVMA LFEGRDAAGK GGAISASSAH MNPRLARVVA LTKPTEREQG       120
     QWYFQRYVAQ FPTAGEFVLF DRSWYNRAGV EPVMGFCTPQ QYEDFLKQTP QLEKIIAHEG       180
     IFFFKFYLDI GREMQLKRFH DRRHDPLKVW KLSSMDIAAL TKWGDYSEKR DRMLKETHTD       240
     FAPWTVIRAN DKRRARLELI RHMLNKMDYD GKDKKALGTV DEEIIGSGLG FLK              293
//

If you have problems or comments...

PBIL Back to PBIL home page