(data stored in ACNUC7421 zone)

EMBL: CP001622.PE176

CP001622.PE176       Location/Qualifiers
FT   CDS             174871..176094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0177"
FT                   /product="histidine kinase"
FT                   /note="KEGG: ret:RHE_CH00508 phosphate regulon,
FT                   two-component sensor histidine kinase protein; TIGRFAM:
FT                   phosphate regulon sensor kinase PhoR; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54488"
FT                   /db_xref="GOA:C6AZG2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG2"
FT                   /inference="protein motif:TFAM:TIGR02966"
FT                   /protein_id="ACS54488.1"
FT                   /translation="MARIRRERPVLLAAILSALAALAAGMNKWVVLALLLVMILTALFN
FT                   EAPVIEAEPALPVEIKPEAPPSRLPEVSATLSGLDIPVMLLSEDASVLFQNRAAEKAFG
FT                   EVALGAHISARMRSPGVLDMVRETIATNAPNQIEHSERLPSERVYIVRSAPIEFAAEDG
FT                   PRERYFILSFRDISEVRRIDRMRSDFVANASHELRTPLASLRGFIETIQGPAKNDLKAQ
FT                   TRFLNIMLDQATRMSRLVDDLLSLSRLELKSHIAPDEKIDLVPLLGHVRDSLVPLAKDV
FT                   GVDINLHLPEGKVEVLGDRDELVQVFENLMENACKYGQEGEIVDVWLKNGTGQPVEVSI
FT                   VDKGPGIPAEHVPRLTERFYRVSIEDSRSKKGTGLGLAIVKHILTRHRARLIVKSEVGK
FT                   GTDFTVRF"
     MARIRRERPV LLAAILSALA ALAAGMNKWV VLALLLVMIL TALFNEAPVI EAEPALPVEI        60
     KPEAPPSRLP EVSATLSGLD IPVMLLSEDA SVLFQNRAAE KAFGEVALGA HISARMRSPG       120
     VLDMVRETIA TNAPNQIEHS ERLPSERVYI VRSAPIEFAA EDGPRERYFI LSFRDISEVR       180
     RIDRMRSDFV ANASHELRTP LASLRGFIET IQGPAKNDLK AQTRFLNIML DQATRMSRLV       240
     DDLLSLSRLE LKSHIAPDEK IDLVPLLGHV RDSLVPLAKD VGVDINLHLP EGKVEVLGDR       300
     DELVQVFENL MENACKYGQE GEIVDVWLKN GTGQPVEVSI VDKGPGIPAE HVPRLTERFY       360
     RVSIEDSRSK KGTGLGLAIV KHILTRHRAR LIVKSEVGKG TDFTVRF                     407
//

If you have problems or comments...

PBIL Back to PBIL home page