(data stored in ACNUC7421 zone)

EMBL: CP001622.PE177

CP001622.PE177       Location/Qualifiers
FT   CDS             176678..177712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0178"
FT                   /product="phosphate ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000584 phosphate ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54489"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000584"
FT                   /protein_id="ACS54489.1"
FT                   /translation="MNTFKLTVAALAATAAFAGAAVARDQIQVAGSSTVLPYAKIVAES
FT                   FGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIANASRPINKNEAEACKAAGVTDI
FT                   QEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVDGKLVANPYKKWSEVNPKLPA
FT                   VDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEIADKAAQGKACVAVRKDGVA
FT                   VDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVASMSGIVPSTETIANGTYPVS
FT                   RPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYGLVAAPDAERDAIRKDVEA
FT                   GKSM"
     MNTFKLTVAA LAATAAFAGA AVARDQIQVA GSSTVLPYAK IVAESFGETF TNFKTPVVES        60
     GGTGAGLKEF CKGVGEDTID IANASRPINK NEAEACKAAG VTDIQEVKIG YDGIVFATDA       120
     SNPDVAYVPA DIYKALAAQV VVDGKLVANP YKKWSEVNPK LPAVDIAAYI PGEKHGTREV       180
     FEQNVLAAGC KASGATDVIA KEIADKAAQG KACVAVRKDG VAVDIDGDYP ETLARIAANK       240
     TGVGVFGLSF YENNADKLKV ASMSGIVPST ETIANGTYPV SRPLFFYVKK AHLGAVPGLK       300
     EYVNFFVSDQ MIGPDSPLVE YGLVAAPDAE RDAIRKDVEA GKSM                        344
//

If you have problems or comments...

PBIL Back to PBIL home page