(data stored in ACNUC7421 zone)

EMBL: CP001622.PE178

CP001622.PE178       Location/Qualifiers
FT   CDS             177883..179364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0179"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG:
FT                   rec:RHECIAT_CH0000585 phosphate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54490"
FT                   /db_xref="GOA:C6AZG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG4"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACS54490.1"
FT                   /translation="MSTSIILLCLVVIGAAAYLVARIRATALAGGRSSALHSRPVYYGA
FT                   YAAIWAVLPALLVLCLWLSISPGIIQSSVRGAFPDDIKAQAAVEQDLGYSTVATVARGM
FT                   TMLTSDETAAVANDPAALQAKLLEKGVPLASQPLPYMLDAAKKLNAMSMTSRIAMTAIV
FT                   FALAVAGAFYALRSIAPRFRARNRVERVMLWGLLLASSIAILTTIGIVFSMLSEAARFF
FT                   AAVPAMDFFFGTVWDPRFAGAGSSSFGQFGLIPLLLGTIYIGLVAMLVAVPVGLFAAIY
FT                   MAEYASPKLRGVAKPLLEVLAGIPTIVYGFFALVTVGPFLRDFSAQISGLLSGNYSNFI
FT                   QAQSVLTAGIVMGIMLIPYVSSLSDDIITAVPRTLRDGSLGLGATRSETIKKVVLPAAL
FT                   PGIVGALLMTASRAIGETMIVVLAAGVAARIQINPFEPMTTVTVKIVNQLTGDLEFTSP
FT                   QTLVAFALGITLFCITLCLNIYALYIVRKYREQYE"
     MSTSIILLCL VVIGAAAYLV ARIRATALAG GRSSALHSRP VYYGAYAAIW AVLPALLVLC        60
     LWLSISPGII QSSVRGAFPD DIKAQAAVEQ DLGYSTVATV ARGMTMLTSD ETAAVANDPA       120
     ALQAKLLEKG VPLASQPLPY MLDAAKKLNA MSMTSRIAMT AIVFALAVAG AFYALRSIAP       180
     RFRARNRVER VMLWGLLLAS SIAILTTIGI VFSMLSEAAR FFAAVPAMDF FFGTVWDPRF       240
     AGAGSSSFGQ FGLIPLLLGT IYIGLVAMLV AVPVGLFAAI YMAEYASPKL RGVAKPLLEV       300
     LAGIPTIVYG FFALVTVGPF LRDFSAQISG LLSGNYSNFI QAQSVLTAGI VMGIMLIPYV       360
     SSLSDDIITA VPRTLRDGSL GLGATRSETI KKVVLPAALP GIVGALLMTA SRAIGETMIV       420
     VLAAGVAARI QINPFEPMTT VTVKIVNQLT GDLEFTSPQT LVAFALGITL FCITLCLNIY       480
     ALYIVRKYRE QYE                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page