(data stored in ACNUC7421 zone)

EMBL: CP001622.PE179

CP001622.PE179       Location/Qualifiers
FT   CDS             179361..180683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0180"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_CH00511
FT                   phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54491"
FT                   /db_xref="GOA:C6AZG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG5"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACS54491.1"
FT                   /translation="MTDIVSPTSGVTVSKAPVRRDIGIKRRYAAERRFQAYGIAAITFG
FT                   LVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPNNKRATDPSVLIAANYPVLLRD
FT                   AIVKQLNVNAASRPDVRDASAMLSKGAPVQLRDMVVADPSIIGKTVNVTVLADANVDSA
FT                   NKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNTGLFVNGNSSRPEAAGLGVAL
FT                   IGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEVNINNLAAVPSIVYGLLGLS
FT                   VFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPSIRAAALGLGASKMQMVF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPTTPLDPSTALPVQVYMW
FT                   ANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW"
     MTDIVSPTSG VTVSKAPVRR DIGIKRRYAA ERRFQAYGIA AITFGLVFLF ILLWTVIGKG        60
     YTAFQQTAIT LPIEFSEKTI DPNNKRATDP SVLIAANYPV LLRDAIVKQL NVNAASRPDV       120
     RDASAMLSKG APVQLRDMVV ADPSIIGKTV NVTVLADANV DSANKGQIDL SVDEKNRKVN       180
     DKQVGWMNEL KASGALHKQF NTGLFVNGNS SRPEAAGLGV ALIGSLYLML IVLVLALPIG       240
     VAASIYLEEF APKNKLTDLI EVNINNLAAV PSIVYGLLGL SVFINFIGLP RSASLVGGLV       300
     LTLMTLPTII IATRAALRAV PPSIRAAALG LGASKMQMVF HHVLPLAMPG ILTGTIIGLA       360
     HALGETAPLL LIGMVAFVAN APTTPLDPST ALPVQVYMWA NEAERAFVER TSGAIIVLLL       420
     FLIVMNMGAI LLRRRFERRW                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page