(data stored in ACNUC7421 zone)

EMBL: CP001622.PE18

CP001622.PE18        Location/Qualifiers
FT   CDS             15910..17172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0018"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   SMART: adenylyl cyclase class-3/4/guanylyl cyclase; KEGG:
FT                   rec:RHECIAT_CH0001286 probable adenylate cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54330"
FT                   /db_xref="GOA:C6AYA6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA6"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACS54330.1"
FT                   /translation="MLLPVENNTVAARGTDKLVHGAEVASASPIIDWLAGDECHALDEA
FT                   GVISGLGRRLRAIGVPVDRLALYLITLHPEYFGRSIAWTEEEPVDIEDRQHGTISLAFM
FT                   DSAISHAMRTRRTVVVGRSGVGASWQCLRTLADRNLEQLIVSPLCNSDGPVSTASFATR
FT                   KPTGFTDIERQIIQRVSPALRNVCELLTLRKVGNTMLDTYIGPYTAQRVRAGHIRQGEV
FT                   ESIDAALLLCDLRGFTKLSNRLPPQEVMQFVNCYYDKVVPSITGNGGEVAKFMGDAVLA
FT                   FFPAYSAEWAAASAYNAAIEISTRTAEATGIKMDVGIALHYGIVNYGNIGSGGRLDFTL
FT                   IGPDVNLVNRIQHVCSEESRQLLMSRSFVEAHIGCERLPIGHRQLKGFERPVELFQGPE
FT                   LDRKLTIDVPHSGSISKQACS"
     MLLPVENNTV AARGTDKLVH GAEVASASPI IDWLAGDECH ALDEAGVISG LGRRLRAIGV        60
     PVDRLALYLI TLHPEYFGRS IAWTEEEPVD IEDRQHGTIS LAFMDSAISH AMRTRRTVVV       120
     GRSGVGASWQ CLRTLADRNL EQLIVSPLCN SDGPVSTASF ATRKPTGFTD IERQIIQRVS       180
     PALRNVCELL TLRKVGNTML DTYIGPYTAQ RVRAGHIRQG EVESIDAALL LCDLRGFTKL       240
     SNRLPPQEVM QFVNCYYDKV VPSITGNGGE VAKFMGDAVL AFFPAYSAEW AAASAYNAAI       300
     EISTRTAEAT GIKMDVGIAL HYGIVNYGNI GSGGRLDFTL IGPDVNLVNR IQHVCSEESR       360
     QLLMSRSFVE AHIGCERLPI GHRQLKGFER PVELFQGPEL DRKLTIDVPH SGSISKQACS       420
//

If you have problems or comments...

PBIL Back to PBIL home page