(data stored in ACNUC7421 zone)

EMBL: CP001622.PE180

CP001622.PE180       Location/Qualifiers
FT   CDS             180700..181515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0181"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000587 phosphate ABC
FT                   transporter, ATP-binding protein; TIGRFAM: phosphate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54492"
FT                   /db_xref="GOA:C6AZG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG6"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACS54492.1"
FT                   /translation="MNMLTEAAVEKALDHKMSNVPYKMIGKDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRSLNRMNDTIDGCRVTGKITLDTDDIYDPDIDVVELRA
FT                   RVGMVFQKPNPFPKTIYENVSYGPRIHGLAKSKADLDQIVETSLQRAGLWNEVKDRVHE
FT                   SGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRENYTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDPRTQDYIMGRFG"
     MNMLTEAAVE KALDHKMSNV PYKMIGKDVS VYYGEKRALF DVNLNIRENT VTALIGPSGC        60
     GKSTFLRSLN RMNDTIDGCR VTGKITLDTD DIYDPDIDVV ELRARVGMVF QKPNPFPKTI       120
     YENVSYGPRI HGLAKSKADL DQIVETSLQR AGLWNEVKDR VHESGTGLSG GQQQRLCIAR       180
     AVAVSPEVIL MDEPCSALDP IATAKVEELI HELRENYTIV IVTHSMQQAA RVSQRTAMFH       240
     LGNLVEENDT DKMFTNPDDP RTQDYIMGRF G                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page