(data stored in ACNUC7421 zone)

EMBL: CP001622.PE181

CP001622.PE181       Location/Qualifiers
FT   CDS             181560..182273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0182"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   rec:RHECIAT_CH0000588 phosphate uptake transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54493"
FT                   /db_xref="GOA:C6AZG7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG7"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ACS54493.1"
FT                   /translation="MASTHIYSAYDDDLKFLSRRISEMGGLAEQMVAEAVRALVNGDTA
FT                   LAQKVISDDVILDHAEREIGDKAIVTIARRQPMAADLREIMGSIRIAADLERVGDLGKN
FT                   TAKRVIAVQSTGVPRKLARGLEHLSELALVQLKEVLDVYTNRSADKANAIRERDNEIDA
FT                   MYTSLFRELLTYMMEDPRNITSCTHLLFCAKNIERIGDHATNIAETIYYMTTGAQPEGD
FT                   RPKDDSANTVGAVTE"
     MASTHIYSAY DDDLKFLSRR ISEMGGLAEQ MVAEAVRALV NGDTALAQKV ISDDVILDHA        60
     EREIGDKAIV TIARRQPMAA DLREIMGSIR IAADLERVGD LGKNTAKRVI AVQSTGVPRK       120
     LARGLEHLSE LALVQLKEVL DVYTNRSADK ANAIRERDNE IDAMYTSLFR ELLTYMMEDP       180
     RNITSCTHLL FCAKNIERIG DHATNIAETI YYMTTGAQPE GDRPKDDSAN TVGAVTE          237
//

If you have problems or comments...

PBIL Back to PBIL home page