(data stored in ACNUC7421 zone)

EMBL: CP001622.PE182

CP001622.PE182       Location/Qualifiers
FT   CDS             182408..183091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0183"
FT                   /product="two component transcriptional regulator PhoB,
FT                   winged helix family"
FT                   /note="KEGG: rec:RHECIAT_CH0000589 phosphate regulon,
FT                   two-component response regulator protein; TIGRFAM:
FT                   phosphate regulon transcriptional regulatory protein PhoB;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54494"
FT                   /db_xref="GOA:C6AZG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG8"
FT                   /inference="protein motif:TFAM:TIGR02154"
FT                   /protein_id="ACS54494.1"
FT                   /translation="MIPRVAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEMRLQER
FT                   TPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLSTGADDYVV
FT                   KPFSTPELVARVKAMLRRARPEVLSTVLKCGDIELDRETHRVHRKTREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAG
FT                   YSMEA"
     MIPRVAVVED EEALSVLLRY NLEAEGFEVD TILRGDEAEM RLQERTPDLL ILDWMLPGVS        60
     GIELCRRLRM RPETERLPII MLTARGEESE RVRGLSTGAD DYVVKPFSTP ELVARVKAML       120
     RRARPEVLST VLKCGDIELD RETHRVHRKT REVRLGPTEF RLLEFLMSSP GRVFSRSQLL       180
     DGVWGHDIYV DERTVDVHVG RLRKALNFSN MQDVIRTVRG AGYSMEA                     227
//

If you have problems or comments...

PBIL Back to PBIL home page