(data stored in ACNUC7421 zone)

EMBL: CP001622.PE183

CP001622.PE183       Location/Qualifiers
FT   CDS             complement(183334..183867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0184"
FT                   /product="GcrA cell cycle regulator"
FT                   /note="PFAM: GcrA cell cycle regulator; KEGG:
FT                   rec:RHECIAT_CH0000590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54495"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG9"
FT                   /inference="protein motif:PFAM:PF07750"
FT                   /protein_id="ACS54495.1"
FT                   /translation="MNWTDERVEKLKKLWAEGLSASQIAAQLGGVSRNAVIGKVHRLCL
FT                   PGRAKAGGTNTAARTPKRNTSAPRAPNFASRITTRTVTRQQGATMLKEEIEIETIEEME
FT                   YVPRGNVVVPISRRLGLTELTERTCKWPVGDPLKDDFHFCGCESPDNSPYCGYHQKLAY
FT                   QPVNERRRAAARAS"
     MNWTDERVEK LKKLWAEGLS ASQIAAQLGG VSRNAVIGKV HRLCLPGRAK AGGTNTAART        60
     PKRNTSAPRA PNFASRITTR TVTRQQGATM LKEEIEIETI EEMEYVPRGN VVVPISRRLG       120
     LTELTERTCK WPVGDPLKDD FHFCGCESPD NSPYCGYHQK LAYQPVNERR RAAARAS          177
//

If you have problems or comments...

PBIL Back to PBIL home page