(data stored in ACNUC7421 zone)

EMBL: CP001622.PE184

CP001622.PE184       Location/Qualifiers
FT   CDS             184288..185487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0185"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: rec:RHECIAT_CH0000591 acetylornithine
FT                   transaminase protein (diaminobutyrate--pyruvate
FT                   aminotransferase); TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54496"
FT                   /db_xref="GOA:C6AZH0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH0"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACS54496.1"
FT                   /translation="MAEAAPLYDTYSRAPLRFERGEGVWLITETGERYLDFGAGVAVTS
FT                   VGHSNPHVVGALKEQADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALEC
FT                   AIKTARRYQFSKGHPERFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAF
FT                   GDIEAVRAAITDATAGILIEPVQGEGGVRPATPEFMKALRQLCDENGLLLILDEVQTGV
FT                   GRTGKLFAHEWSGVTPDIMAVAKGIGGGFPLGACLATSEAASGMKAGTHGSTYGGNPLA
FT                   MAVGSAVLDIILADGFLQQVRDVALVFRQGLASLKDRYPDVIEDVRGEGLLLGIKAAVP
FT                   SAELLQAIRAAHLLGVPAGDNVIRLLPPLVVTAEEAREGLSRVERAAESIRASKVKKTA
FT                   "
     MAEAAPLYDT YSRAPLRFER GEGVWLITET GERYLDFGAG VAVTSVGHSN PHVVGALKEQ        60
     ADKVWHLSNI YEIPGQERLA KRLTDATFAD KVFFTNSGAE ALECAIKTAR RYQFSKGHPE       120
     RFHIITFEGA FHGRTLATIA AGGQEKYLEG FGPKAPGFDQ VAFGDIEAVR AAITDATAGI       180
     LIEPVQGEGG VRPATPEFMK ALRQLCDENG LLLILDEVQT GVGRTGKLFA HEWSGVTPDI       240
     MAVAKGIGGG FPLGACLATS EAASGMKAGT HGSTYGGNPL AMAVGSAVLD IILADGFLQQ       300
     VRDVALVFRQ GLASLKDRYP DVIEDVRGEG LLLGIKAAVP SAELLQAIRA AHLLGVPAGD       360
     NVIRLLPPLV VTAEEAREGL SRVERAAESI RASKVKKTA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page