(data stored in ACNUC7421 zone)

EMBL: CP001622.PE185

CP001622.PE185       Location/Qualifiers
FT   CDS             185530..186444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0186"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: ret:RHE_CH00517 ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54497"
FT                   /db_xref="GOA:C6AZH1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH1"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACS54497.1"
FT                   /translation="MSPKHFLDLSAVTSADLRTIMNDALARKQAFKAGQGDKPLAGKML
FT                   AMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIR
FT                   TTEHSRLVELAQHATVPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNV
FT                   LHSLVEGAARFGYRMNMAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTD
FT                   TWVSMNQEHRARGHNVFQPYQVNAALMAKAGNDALFMHCLPAHRGEEVTDEVIDGPQSV
FT                   VFDEAENRLHAQKSILAWCLGAI"
     MSPKHFLDLS AVTSADLRTI MNDALARKQA FKAGQGDKPL AGKMLAMIFE KPSTRTRVSF        60
     DVGMRQLGGE TLFLSGTEMQ LGRAETIGDT AKVLSRYVDA IMIRTTEHSR LVELAQHATV       120
     PVINALTDDT HPCQIMADIM TFEEHRGPIK GKTIAWTGDG NNVLHSLVEG AARFGYRMNM       180
     AVPLGSEPKD HYLNWARNEG AEIMLCHDAD RAVAGVDCVV TDTWVSMNQE HRARGHNVFQ       240
     PYQVNAALMA KAGNDALFMH CLPAHRGEEV TDEVIDGPQS VVFDEAENRL HAQKSILAWC       300
     LGAI                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page