(data stored in ACNUC7421 zone)

EMBL: CP001622.PE186

CP001622.PE186       Location/Qualifiers
FT   CDS             186535..187527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0187"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: rec:RHECIAT_CH0000593 33K
FT                   chaperonin (heat shock protein 33) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54498"
FT                   /db_xref="GOA:C6AZH2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH2"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACS54498.1"
FT                   /translation="MAEAAAALGQFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHHYPAPVARLLAEVVVLTVLLGTSLKFDGKFTVQTKGDGPVDLLVADFSTPENVRAYA
FT                   RFDQALLNKAIESGETEPEQLLGKGVLAFTIDQGKFSQPYQGIVPLDGTTLEDIAGVYF
FT                   RQSEQIPTRVRLAAAELFDRDDAGKPRHRWRAGGLVAQFLPEAPERMRQPDLHGGDGDT
FT                   GSRPHGEDDAWLEARSLVETIDADELTDPLVGTERLLFRLFHERGVRVYEPRAVFDRCS
FT                   CSRDKIKGVLKGFSAEEIEASQEDGEIAVTCEFCSTTYRFEPAELQPAE"
     MAEAAAALGQ FDFAGDDHVV PFQVEGLDVR GRAVQLGPML DAILERHHYP APVARLLAEV        60
     VVLTVLLGTS LKFDGKFTVQ TKGDGPVDLL VADFSTPENV RAYARFDQAL LNKAIESGET       120
     EPEQLLGKGV LAFTIDQGKF SQPYQGIVPL DGTTLEDIAG VYFRQSEQIP TRVRLAAAEL       180
     FDRDDAGKPR HRWRAGGLVA QFLPEAPERM RQPDLHGGDG DTGSRPHGED DAWLEARSLV       240
     ETIDADELTD PLVGTERLLF RLFHERGVRV YEPRAVFDRC SCSRDKIKGV LKGFSAEEIE       300
     ASQEDGEIAV TCEFCSTTYR FEPAELQPAE                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page