(data stored in ACNUC7421 zone)

EMBL: CP001622.PE187

CP001622.PE187       Location/Qualifiers
FT   CDS             187660..188247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54499"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000594"
FT                   /protein_id="ACS54499.1"
FT                   /translation="MRLLFFVLALIAAMPPVSLADDQTVPWKEVGGWSVAVDPTLDNGC
FT                   FVLTSFDDDTIFRLGFNFRKKDNPLYILLGNPNWKSLEKGKHYPIELSFDQSKRTADGR
FT                   GLDLDGLKSLWIDFEDPDLIEEFAGKLSFRASFGGKQIVALGLKDSASAADELLACQKA
FT                   VNDAVAKHPAPPQSKDPFEAKPGTQASDPFDL"
     MRLLFFVLAL IAAMPPVSLA DDQTVPWKEV GGWSVAVDPT LDNGCFVLTS FDDDTIFRLG        60
     FNFRKKDNPL YILLGNPNWK SLEKGKHYPI ELSFDQSKRT ADGRGLDLDG LKSLWIDFED       120
     PDLIEEFAGK LSFRASFGGK QIVALGLKDS ASAADELLAC QKAVNDAVAK HPAPPQSKDP       180
     FEAKPGTQAS DPFDL                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page