(data stored in ACNUC7421 zone)

EMBL: CP001622.PE188

CP001622.PE188       Location/Qualifiers
FT   CDS             complement(188383..188775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0189"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: ret:RHE_CH00521
FT                   ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54500"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH4"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ACS54500.1"
FT                   /translation="MYRALTREIEVVVEPFYLEEQSDPDDDRYVWGYRIVISNNSGIAV
FT                   RLVNRYWNITDQNGQVDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMFGHYQME
FT                   TDDGEMFDVDIPAFSLDSPGLLRVLN"
     MYRALTREIE VVVEPFYLEE QSDPDDDRYV WGYRIVISNN SGIAVRLVNR YWNITDQNGQ        60
     VDEVTGPGVV GEQPRLSPGD TYEYSSGCPL DTPSGLMFGH YQMETDDGEM FDVDIPAFSL       120
     DSPGLLRVLN                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page