(data stored in ACNUC7421 zone)

EMBL: CP001622.PE189

CP001622.PE189       Location/Qualifiers
FT   CDS             complement(189146..190330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0190"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.4.1.1"
FT                   /note="KEGG: ret:RHE_CH00522 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54501"
FT                   /db_xref="GOA:C6AZH5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH5"
FT                   /inference="protein motif:TFAM:TIGR01325"
FT                   /protein_id="ACS54501.1"
FT                   /translation="MSKTWRPATQLVHGGTLRSQYGETSEAIYLTQGFVYETSEAAEAR
FT                   FKGETEGFIYARYGSPTNDMFEKRMCMLEGAEDARATASGMAAVTAAILCQLKSGDHIV
FT                   AARALFGSCRWVVETLAPKYGIDCTLIDGRDLANWEKAITPKTKVFFLESPTNPTLEVI
FT                   DIAGVAKLANQVGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLS
FT                   DKEWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVRQQTENAAKIADFLAEQGKV
FT                   AKVIYPGRKDHPQADIIAKQMTGGSTLVAFELKGGKDAAFALQNALDIVKISNNLGDSK
FT                   SLITHPATTTHKNLTDEARAELGISPGTVRLSAGIEDTDDLIEDFAKALDKVLA"
     MSKTWRPATQ LVHGGTLRSQ YGETSEAIYL TQGFVYETSE AAEARFKGET EGFIYARYGS        60
     PTNDMFEKRM CMLEGAEDAR ATASGMAAVT AAILCQLKSG DHIVAARALF GSCRWVVETL       120
     APKYGIDCTL IDGRDLANWE KAITPKTKVF FLESPTNPTL EVIDIAGVAK LANQVGAKVV       180
     VDNVFATPLF QKPLELGAHI VVYSATKHID GQGRCLGGVV LSDKEWIDEN LHDYFRHTGP       240
     AMSPFNAWTL LKGIETLPLR VRQQTENAAK IADFLAEQGK VAKVIYPGRK DHPQADIIAK       300
     QMTGGSTLVA FELKGGKDAA FALQNALDIV KISNNLGDSK SLITHPATTT HKNLTDEARA       360
     ELGISPGTVR LSAGIEDTDD LIEDFAKALD KVLA                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page