(data stored in ACNUC7421 zone)

EMBL: CP001622.PE19

CP001622.PE19        Location/Qualifiers
FT   CDS             complement(17871..18377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_1919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54331"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA7"
FT                   /inference="similar to AA sequence:KEGG:Msil_1919"
FT                   /protein_id="ACS54331.1"
FT                   /translation="MTDSNGISVVRTPVWIEHIRIVSKRSFDQVKTKIEKLPHFDNGIR
FT                   KILRDGDFVRVKKELERLQGSAGLIIFSVATHGDWLAIRGGSRHALQYVIGNVLISSEM
FT                   TKHQLPAGLYAPLRIMLYENEEGTATLEYDRPSDLFGQFNDDRVTSVAEHLDQQIYDCL
FT                   VAAAA"
     MTDSNGISVV RTPVWIEHIR IVSKRSFDQV KTKIEKLPHF DNGIRKILRD GDFVRVKKEL        60
     ERLQGSAGLI IFSVATHGDW LAIRGGSRHA LQYVIGNVLI SSEMTKHQLP AGLYAPLRIM       120
     LYENEEGTAT LEYDRPSDLF GQFNDDRVTS VAEHLDQQIY DCLVAAAA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page